Anti-ASAP1, Mouse, Rabbit-Poly<Anti-KIAA1249>(Cat.No.MK12490505)

Price: $577.00
  • Item #: MK12490505
* Marked fields are required.
Qty: *

Anti-ASAP1, Mouse, Rabbit-Poly <Anti-KIAA1249>
Cat. No. MK12490505
Store at -20°C
Size 0.05mg
Antigen- Mouse 
Host Animal- Rabbit 
Cross Reactivity- Human/ Mouse 
Application- IHC, Western Blot 
Unlabeled 
Purification- APu

 

 

Description 

Mouse KIAA1249 (mKIAA1249) protein is a homologue of human KIAA1249 (ref. 1, 2). KIAA1249 is identical to ASAP-1/DEF-1 (ASAP1) (ref. 3, 4). Rabbit anti-mouse ASAP1 (mASAP1, mKIAA1249) antibody is raised against GST-fused recombinant protein (GX0137) containing following sequence:

(157 amino acids) PKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASE DSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPER KGVFPVSFVHILSD 

 

References

1. Hara, Y. et al.: DNA Res., 10, 129 (2003).

2. Koga, H. et al.: DNA Res., 11, 293 (2004).

3. Brown, M.T. et al.: Mol. Cell Biol., 18, 7038 (1998)

4. King, F.J. et al.: Mol. Cell Biol., 19, 2330 (1999)

Reviews (0) Write a Review
No Reviews. Write a Review